SCOPe 2.08: Domain d5hc6a_: 5hc6 A:

Lineage for d5hc6a_ (5hc6 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156

4. Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families)
   the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase

5. Family c.101.1.0: automated matches [191361] (1 protein)
   not a true family

6. Protein automated matches [190431] (13 species)
   not a true protein

7. Species Lavandula lanata [TaxId:39330] [315377] (3 PDB entries)

8. Domain d5hc6a_: 5hc6 A: [315378]
   automated match to d2d2rb_
   complexed with so4

Details for d5hc6a_

PDB Entry: 5hc6, 2.15 Å

PDB Description: crystal structure of lavandulyl diphosphate synthase from lavandula x intermedia in apo form

PDB Compounds: (A:) prenyltransference for protein

SCOPe Domain Sequences for d5hc6a_:

Sequence; same for both SEQRES and ATOM records:

>d5hc6a_ c.101.1.0 (A:) automated matches {Lavandula lanata [TaxId: 39330]}
devtpnhvaiiidghrkwaksrgvtvqeghqtgvnnwkhiisrasqlgiklltiwalspq
nfnrskmevdflmriyedflrsdvkelvtsqqdiqfsaigdksrlpeylqdaisyaegls
qankgmhfilavayggrediveaarkiaakvehgilrpddideatfeqhlmtnitkfpsp
dlliraageqrlsnfflwqlpftefyftpklfpdfgeadlldalasyrcr

Timeline for d5hc6a_:

• d5hc6a_ first appeared in SCOPe 2.06
  
• d5hc6a_ appears in SCOPe 2.07