Lineage for d5i8ta_ (5i8t A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2080271Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2080272Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2080528Family b.82.1.6: Acireductone dioxygenase [82191] (2 proteins)
    automatically mapped to Pfam PF03079
  6. 2080529Protein Acireductone dioxygenase [82192] (2 species)
  7. 2080532Species Mouse (Mus musculus) [TaxId:10090] [141601] (6 PDB entries)
    Uniprot Q99JT9 1-179
  8. 2080534Domain d5i8ta_: 5i8t A: [315373]
    automated match to d1vr3a1
    complexed with ipa, lac, ni

Details for d5i8ta_

PDB Entry: 5i8t (more details), 1.75 Å

PDB Description: structure of mouse acireductone dioxygenase with ni2+ ion and d-lactic acid in the active site
PDB Compounds: (A:) 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase

SCOPe Domain Sequences for d5i8ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i8ta_ b.82.1.6 (A:) Acireductone dioxygenase {Mouse (Mus musculus) [TaxId: 10090]}
mvqawymdestadprkphraqpdrpvsleqlrtlgvlywkldadkyendpelekirkmrn
yswmdiitickdtlpnyeekikmffeehlhldeeiryilegsgyfdvrdkedkwirisme
kgdmitlpagiyhrftldeknyvkamrlfvgepvwtpynrpadhfdarvqymsflegta

SCOPe Domain Coordinates for d5i8ta_:

Click to download the PDB-style file with coordinates for d5i8ta_.
(The format of our PDB-style files is described here.)

Timeline for d5i8ta_: