Lineage for d5fjqa_ (5fjq A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2375023Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2376005Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2376006Protein automated matches [190226] (72 species)
    not a true protein
  7. 2376326Species Pseudomonas cellulosa (Cellvibrio japonicus) [TaxId:155077] [315362] (1 PDB entry)
  8. 2376327Domain d5fjqa_: 5fjq A: [315363]
    automated match to d2bena_
    complexed with cu

Details for d5fjqa_

PDB Entry: 5fjq (more details), 1.85 Å

PDB Description: structural and functional analysis of a lytic polysaccharide monooxygenase important for efficient utilization of chitin in cellvibrio japonicus
PDB Compounds: (A:) carbohydrate binding protein, putative, cpb33a

SCOPe Domain Sequences for d5fjqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fjqa_ b.1.18.0 (A:) automated matches {Pseudomonas cellulosa (Cellvibrio japonicus) [TaxId: 155077]}
hgyvsspksrviqckengienpthpaciaakaagngglytpqevavggvrdnhdyyipdg
rlcsanranlfgmdlarndwpatsvtpgarefvwtntaahktkyfryyitpqgydhsqpl
rwsdlqlihdsgpadqewvsthnvilpyrtgrhiiysiwqrdwdrdaaegfyqcidvdfg

SCOPe Domain Coordinates for d5fjqa_:

Click to download the PDB-style file with coordinates for d5fjqa_.
(The format of our PDB-style files is described here.)

Timeline for d5fjqa_: