Lineage for d1gaqc2 (1gaq C:157-314)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 827305Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 827306Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 827307Family c.25.1.1: Reductases [52344] (4 proteins)
  6. 827318Protein Ferredoxin reductase (flavodoxin reductase) [52345] (8 species)
  7. 827359Species Maize (Zea mays), leaf isoform [TaxId:4577] [52349] (2 PDB entries)
  8. 827363Domain d1gaqc2: 1gaq C:157-314 [31536]
    Other proteins in same PDB: d1gaqa1, d1gaqb_, d1gaqc1
    complexed with fad, fes

Details for d1gaqc2

PDB Entry: 1gaq (more details), 2.59 Å

PDB Description: crystal structure of the complex between ferredoxin and ferredoxin-nadp+ reductase
PDB Compounds: (C:) ferredoxin-nadp+ reductase

SCOP Domain Sequences for d1gaqc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gaqc2 c.25.1.1 (C:157-314) Ferredoxin reductase (flavodoxin reductase) {Maize (Zea mays), leaf isoform [TaxId: 4577]}
mpkdpnatiimlatgtgiapfrsflwkmffekhddykfnglgwlflgvptsssllykeef
gkmkerapenfrvdyavsreqtnaagermyiqtrmaeykeelwellkkdntyvymcglkg
mekgiddimvslaekdgidwfdykkqlkrgdqwnvevy

SCOP Domain Coordinates for d1gaqc2:

Click to download the PDB-style file with coordinates for d1gaqc2.
(The format of our PDB-style files is described here.)

Timeline for d1gaqc2: