SCOPe 2.08: Domain d5g0re1: 5g0r E:2-188

Lineage for d5g0re1 (5g0r E:2-188)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families)
   each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures

5. Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (3 proteins)
   C-terminal domain is all-alpha

6. Protein automated matches [315351] (3 species)
   not a true protein

7. Species Methanothermobacter marburgensis [TaxId:145263] [315352] (2 PDB entries)

8. Domain d5g0re1: 5g0r E:2-188 [315353]
   Other proteins in same PDB: d5g0ra2, d5g0rb2, d5g0rc_, d5g0rd2, d5g0re2, d5g0rf_
   automated match to d1hbnb2
   complexed with cl, f43, k, mg, na, tp7

Details for d5g0re1

PDB Entry: 5g0r, 1.25 Å

PDB Description: methyl-coenzyme m reductase i from methanothermobacter marburgensis exposed to 3-nitrooxypropanol

PDB Compounds: (E:) Methyl-coenzyme M reductase I subunit beta

SCOPe Domain Sequences for d5g0re1:

Sequence; same for both SEQRES and ATOM records:

>d5g0re1 d.58.31.2 (E:2-188) automated matches {Methanothermobacter marburgensis [TaxId: 145263]}
akfedkvdlyddrgnlveeqvplealsplrnpaiksivqgikrtvavnlegienalktak
vggpackimgreldldivgnaesiaaaakemiqvtedddtnvellgggkralvqvpsarf
dvaaeysaaplvtatafvqaiinefdvsmydanmvkaavlgrypqsveymganiatmldi
pqklegp

Timeline for d5g0re1:

• d5g0re1 first appeared in SCOPe 2.06
  
• d5g0re1 appears in SCOPe 2.07