Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures |
Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (3 proteins) C-terminal domain is all-alpha |
Protein automated matches [315351] (3 species) not a true protein |
Species Methanothermobacter marburgensis [TaxId:145263] [315352] (2 PDB entries) |
Domain d5g0re1: 5g0r E:2-188 [315353] Other proteins in same PDB: d5g0ra2, d5g0rb2, d5g0rc_, d5g0rd2, d5g0re2, d5g0rf_ automated match to d1hbnb2 complexed with cl, f43, k, mg, na, tp7 |
PDB Entry: 5g0r (more details), 1.25 Å
SCOPe Domain Sequences for d5g0re1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5g0re1 d.58.31.2 (E:2-188) automated matches {Methanothermobacter marburgensis [TaxId: 145263]} akfedkvdlyddrgnlveeqvplealsplrnpaiksivqgikrtvavnlegienalktak vggpackimgreldldivgnaesiaaaakemiqvtedddtnvellgggkralvqvpsarf dvaaeysaaplvtatafvqaiinefdvsmydanmvkaavlgrypqsveymganiatmldi pqklegp
Timeline for d5g0re1: