Lineage for d1gaqa2 (1gaq A:157-314)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1841107Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 1841108Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 1841109Family c.25.1.1: Reductases [52344] (5 proteins)
  6. 1841126Protein Ferredoxin reductase (flavodoxin reductase) [52345] (9 species)
  7. 1841152Species Maize (Zea mays), leaf isoform [TaxId:4577] [52349] (2 PDB entries)
  8. 1841155Domain d1gaqa2: 1gaq A:157-314 [31535]
    Other proteins in same PDB: d1gaqa1, d1gaqb_, d1gaqc1
    complexed with fad, fes

Details for d1gaqa2

PDB Entry: 1gaq (more details), 2.59 Å

PDB Description: crystal structure of the complex between ferredoxin and ferredoxin-nadp+ reductase
PDB Compounds: (A:) ferredoxin-nadp+ reductase

SCOPe Domain Sequences for d1gaqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gaqa2 c.25.1.1 (A:157-314) Ferredoxin reductase (flavodoxin reductase) {Maize (Zea mays), leaf isoform [TaxId: 4577]}
mpkdpnatiimlatgtgiapfrsflwkmffekhddykfnglgwlflgvptsssllykeef
gkmkerapenfrvdyavsreqtnaagermyiqtrmaeykeelwellkkdntyvymcglkg
mekgiddimvslaekdgidwfdykkqlkrgdqwnvevy

SCOPe Domain Coordinates for d1gaqa2:

Click to download the PDB-style file with coordinates for d1gaqa2.
(The format of our PDB-style files is described here.)

Timeline for d1gaqa2: