SCOP 1.75: Domain d1gaqa2: 1gaq A:157-314

Lineage for d1gaqa2 (1gaq A:157-314)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families)
   binds NADP differently than classical Rossmann-fold
   N-terminal FAD-linked domain contains (6,10) barrel

5. Family c.25.1.1: Reductases [52344] (4 proteins)

6. Protein Ferredoxin reductase (flavodoxin reductase) [52345] (8 species)

7. Species Maize (Zea mays), leaf isoform [TaxId:4577] [52349] (2 PDB entries)

8. Domain d1gaqa2: 1gaq A:157-314 [31535]
   Other proteins in same PDB: d1gaqa1, d1gaqb_, d1gaqc1

Details for d1gaqa2

PDB Entry: 1gaq, 2.59 Å

PDB Description: crystal structure of the complex between ferredoxin and ferredoxin-nadp+ reductase

PDB Compounds: (A:) ferredoxin-nadp+ reductase

SCOP Domain Sequences for d1gaqa2:

Sequence; same for both SEQRES and ATOM records:

>d1gaqa2 c.25.1.1 (A:157-314) Ferredoxin reductase (flavodoxin reductase) {Maize (Zea mays), leaf isoform [TaxId: 4577]}
mpkdpnatiimlatgtgiapfrsflwkmffekhddykfnglgwlflgvptsssllykeef
gkmkerapenfrvdyavsreqtnaagermyiqtrmaeykeelwellkkdntyvymcglkg
mekgiddimvslaekdgidwfdykkqlkrgdqwnvevy

Timeline for d1gaqa2:

• d1gaqa2 first appeared (with stable ids) in SCOP 1.55
  
• d1gaqa2 appears in SCOP 1.73
  
• d1gaqa2 appears in SCOPe 2.01
  
• d1gaqa2 appears in the current release, SCOPe 2.08