Lineage for d1gaqa2 (1gaq A:157-314)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 68846Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
  4. 68847Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) (S)
  5. 68848Family c.25.1.1: Reductases [52344] (4 proteins)
  6. 68852Protein Ferredoxin reductase (flavodoxin reductase) [52345] (8 species)
  7. 68876Species Maize (Zea mays), leaf isoform [TaxId:4577] [52349] (2 PDB entries)
  8. 68879Domain d1gaqa2: 1gaq A:157-314 [31535]
    Other proteins in same PDB: d1gaqa1, d1gaqb_, d1gaqc1

Details for d1gaqa2

PDB Entry: 1gaq (more details), 2.59 Å

PDB Description: crystal structure of the complex between ferredoxin and ferredoxin-nadp+ reductase

SCOP Domain Sequences for d1gaqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gaqa2 c.25.1.1 (A:157-314) Ferredoxin reductase (flavodoxin reductase) {Maize (Zea mays), leaf isoform}
mpkdpnatiimlatgtgiapfrsflwkmffekhddykfnglgwlflgvptsssllykeef
gkmkerapenfrvdyavsreqtnaagermyiqtrmaeykeelwellkkdntyvymcglkg
mekgiddimvslaekdgidwfdykkqlkrgdqwnvevy

SCOP Domain Coordinates for d1gaqa2:

Click to download the PDB-style file with coordinates for d1gaqa2.
(The format of our PDB-style files is described here.)

Timeline for d1gaqa2: