Lineage for d5ij5a2 (5ij5 A:196-387)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2343304Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 2343305Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 2343749Family a.126.1.0: automated matches [254216] (1 protein)
    not a true family
  6. 2343750Protein automated matches [254493] (6 species)
    not a true protein
  7. 2343804Species Horse (Equus caballus) [TaxId:9796] [256129] (26 PDB entries)
  8. 2343869Domain d5ij5a2: 5ij5 A:196-387 [315344]
    automated match to d1hk5a2
    complexed with gol, zn

Details for d5ij5a2

PDB Entry: 5ij5 (more details), 2.55 Å

PDB Description: crystal structure of equine serum albumin in the presence of 50 mm zinc at ph 4.5
PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d5ij5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ij5a2 a.126.1.0 (A:196-387) automated matches {Horse (Equus caballus) [TaxId: 9796]}
rlkcssfqnfgeravkawsvarlsqkfpkadfaevskivtdltkvhkecchgdllecadd
radlakyicehqdsisgklkaccdkpllqkshciaevkeddlpsdlpalaadfaedkeic
khykdakdvflgtflyeysrrhpdysvslllriaktyeatlekccaeadppacyrtvfdq
ftplveepkslv

SCOPe Domain Coordinates for d5ij5a2:

Click to download the PDB-style file with coordinates for d5ij5a2.
(The format of our PDB-style files is described here.)

Timeline for d5ij5a2: