SCOPe 2.06: Domain d5fmol2: 5fmo L:183-370

Lineage for d5fmol2 (5fmo L:183-370)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.2: Comoviridae-like VP [88636] (3 proteins)
   duplication: mature coat protein consists of three similar domains that can be in a single chain or in two separate chains

6. Protein automated matches [310893] (1 species)
   not a true protein

7. Species CPMV (Cowpea mosaic virus) [TaxId:12264] [311486] (2 PDB entries)

8. Domain d5fmol2: 5fmo L:183-370 [315339]
   automated match to d1ny722

Details for d5fmol2

PDB Entry: 5fmo, 2.3 Å

PDB Description: crystal structure and proteomics analysis of empty virus like particles of cowpea mosaic virus

PDB Compounds: (L:) empty virus like particles of cowpea mosaic virus

SCOPe Domain Sequences for d5fmol2:

Sequence; same for both SEQRES and ATOM records:

>d5fmol2 b.121.4.2 (L:183-370) automated matches {CPMV (Cowpea mosaic virus) [TaxId: 12264]}
hladcqnwlplnrwmgkltfpqgvtsevrrmplsigggagatqaflanmpnswismwryf
rgelhfevtkmsspyikatvtfliafgnlsdafgfyesfphrivqfaeveekctlvfsqq
efvtawstqvnprttleadgcpylyaiihdsttgtisgdfnlgvklvgikdfcgigsnpg
idgsrllg

Timeline for d5fmol2:

• d5fmol2 is new in SCOPe 2.06-stable
  
• d5fmol2 appears in SCOPe 2.07
  
• d5fmol2 appears in the current release, SCOPe 2.08