Lineage for d5fmol1 (5fmo L:1-182)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2409884Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2410108Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2410482Family b.121.4.2: Comoviridae-like VP [88636] (3 protein domains)
    duplication: mature coat protein consists of three similar domains that can be in a single chain or in two separate chains
  6. 2410506Protein automated matches [310893] (1 species)
    not a true protein
  7. 2410507Species CPMV (Cowpea mosaic virus) [TaxId:12264] [311486] (2 PDB entries)
  8. 2410508Domain d5fmol1: 5fmo L:1-182 [315338]
    automated match to d1ny721

Details for d5fmol1

PDB Entry: 5fmo (more details), 2.3 Å

PDB Description: crystal structure and proteomics analysis of empty virus like particles of cowpea mosaic virus
PDB Compounds: (L:) empty virus like particles of cowpea mosaic virus

SCOPe Domain Sequences for d5fmol1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fmol1 b.121.4.2 (L:1-182) automated matches {CPMV (Cowpea mosaic virus) [TaxId: 12264]}
meqnlfalslddtssvrgslldtkfaqtrvllskamaggdvlldeylydvvngqdfratv
aflrthvitgkikvtattnisdnsgcclmlainsgvrgkystdvyticsqdsmtwnpgck
knfsftfnpnpcgdswsaemisrsrvrmtvicvsgwtlspttdviakldwsivnekcept
iy

SCOPe Domain Coordinates for d5fmol1:

Click to download the PDB-style file with coordinates for d5fmol1.
(The format of our PDB-style files is described here.)

Timeline for d5fmol1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5fmol2
View in 3D
Domains from other chains:
(mouse over for more information)
d5fmos_