Lineage for d1gawa2 (1gaw A:157-314)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 693238Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 693239Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 693240Family c.25.1.1: Reductases [52344] (4 proteins)
  6. 693251Protein Ferredoxin reductase (flavodoxin reductase) [52345] (8 species)
  7. 693292Species Maize (Zea mays), leaf isoform [TaxId:4577] [52349] (2 PDB entries)
  8. 693293Domain d1gawa2: 1gaw A:157-314 [31533]
    Other proteins in same PDB: d1gawa1, d1gawb1

Details for d1gawa2

PDB Entry: 1gaw (more details), 2.2 Å

PDB Description: crystal structure analysis of the ferredoxin-nadp+ reductase from maize leaf
PDB Compounds: (A:) ferredoxin-nadp+ reductase

SCOP Domain Sequences for d1gawa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gawa2 c.25.1.1 (A:157-314) Ferredoxin reductase (flavodoxin reductase) {Maize (Zea mays), leaf isoform [TaxId: 4577]}
mpkdpnatiimlatgtgiapfrsflwkmffekhddykfnglgwlflgvptsssllykeef
gkmkerapenfrvdyavsreqtnaagermyiqtrmaeykeelwellkkdntyvymcglkg
mekgiddimvslaekdgidwfdykkqlkrgdqwnvevy

SCOP Domain Coordinates for d1gawa2:

Click to download the PDB-style file with coordinates for d1gawa2.
(The format of our PDB-style files is described here.)

Timeline for d1gawa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gawa1