Lineage for d5dnfg_ (5dnf G:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2175338Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2175339Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2175340Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 2175548Protein RANTES (regulated upon activation, normal T-cell expressed and secreted) [54132] (1 species)
    has different dimerisation mode
  7. 2175549Species Human (Homo sapiens) [TaxId:9606] [54133] (14 PDB entries)
    Uniprot P13501 25-91
  8. 2175581Domain d5dnfg_: 5dnf G: [315328]
    automated match to d1u4lb_
    complexed with bgc, cl, gla, ids, sgn, so4, trs

Details for d5dnfg_

PDB Entry: 5dnf (more details), 2.55 Å

PDB Description: crystal structure of cc chemokine 5 (ccl5) oligomer in complex with heparin
PDB Compounds: (G:) c-c motif chemokine 5

SCOPe Domain Sequences for d5dnfg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dnfg_ d.9.1.1 (G:) RANTES (regulated upon activation, normal T-cell expressed and secreted) {Human (Homo sapiens) [TaxId: 9606]}
ssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvreyin
slems

SCOPe Domain Coordinates for d5dnfg_:

Click to download the PDB-style file with coordinates for d5dnfg_.
(The format of our PDB-style files is described here.)

Timeline for d5dnfg_: