Lineage for d5i1ua_ (5i1u A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2337561Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2337562Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2337969Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2337970Protein automated matches [196409] (38 species)
    not a true protein
  7. 2338101Species Streptomyces citricolor [TaxId:212427] [315296] (1 PDB entry)
  8. 2338102Domain d5i1ua_: 5i1u A: [315324]
    automated match to d5dz2a_
    complexed with so4

Details for d5i1ua_

PDB Entry: 5i1u (more details), 1.5 Å

PDB Description: crystal structure of germacradien-4-ol synthase from streptomyces citricolor
PDB Compounds: (A:) Germacradien-4-ol synthase

SCOPe Domain Sequences for d5i1ua_:

Sequence, based on SEQRES records: (download)

>d5i1ua_ a.128.1.0 (A:) automated matches {Streptomyces citricolor [TaxId: 212427]}
msddtslelpfthrrnphqteaadrhlewlqrhrelaavvsgstytgwditelaslvype
ssaedlalaadlmgfyflfddqfdsplgrrpeqvalicerlsaiahgtltavtspseraf
adlwrritlgmtdrwraraacnweyyfachpaeaagrtigqppdregyltlrrgtaames
ifdmierlghfevpqhvmhhplfrqlrqlaadipsftndvrsfaqesergdvanlvmivr
rdrccstaeacavvwdeaqrmadrfcdlrdqlpdacrsmsldpaqrlaaeryadgmalwl
agylhwesht

Sequence, based on observed residues (ATOM records): (download)

>d5i1ua_ a.128.1.0 (A:) automated matches {Streptomyces citricolor [TaxId: 212427]}
msddtslelpfthrrnphqteaadrhlewlqrhrelaavvsgstytgwditelaslvype
ssaedlalaadlmgfyflfddqfdsplgrrpeqvalicerlsaiahgtltavtspseraf
adlwrritlgmtdrwraraacnweyyfachpaeaagrppdregyltlrrgtaamesifdm
ierlghfevpqhvmhhplfrqlrqlaadipsftndvrsfaqeanlvmivrrdrccstaea
cavvwdeaqrmadrfcdlrdqlpdacrsmsldpaqrlaaeryadgmalwlagylhwesht

SCOPe Domain Coordinates for d5i1ua_:

Click to download the PDB-style file with coordinates for d5i1ua_.
(The format of our PDB-style files is described here.)

Timeline for d5i1ua_: