Lineage for d5i1ra_ (5i1r A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640942Fold g.40: Retrovirus zinc finger-like domains [57755] (1 superfamily)
    metal(zinc)-bound fold
  4. 2640943Superfamily g.40.1: Retrovirus zinc finger-like domains [57756] (1 family) (S)
  5. 2640944Family g.40.1.1: Retrovirus zinc finger-like domains [57757] (6 proteins)
  6. 2640972Protein Zinc finger protein ncp10 [57765] (3 species)
  7. 2640975Species Human immunodeficiency virus type 1 (hxb2 isolate) [TaxId:11706] [346433] (1 PDB entry)
  8. 2640976Domain d5i1ra_: 5i1r A: [315320]
    automated match to d1aafa_
    complexed with zn

Details for d5i1ra_

PDB Entry: 5i1r (more details)

PDB Description: quantitative characterization of configurational space sampled by hiv- 1 nucleocapsid using solution nmr and x-ray scattering
PDB Compounds: (A:) Nucleocapsid protein p7

SCOPe Domain Sequences for d5i1ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i1ra_ g.40.1.1 (A:) Zinc finger protein ncp10 {Human immunodeficiency virus type 1 (hxb2 isolate) [TaxId: 11706]}
mqrgnfrnqrkivkcfncgkeghtarncraprkkgcwkcgkeghqmkdcterqan

SCOPe Domain Coordinates for d5i1ra_:

Click to download the PDB-style file with coordinates for d5i1ra_.
(The format of our PDB-style files is described here.)

Timeline for d5i1ra_: