Lineage for d1fb3a2 (1fb3 A:208-362)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22422Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
  4. 22423Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) (S)
  5. 22424Family c.25.1.1: Reductases [52344] (4 proteins)
  6. 22428Protein Ferredoxin reductase (flavodoxin reductase) [52345] (7 species)
  7. Species Paprika (Capsicum annuum) [TaxId:4072] [52348] (1 PDB entry)
  8. Domain d1fb3a2: 1fb3 A:208-362 [31531]
    Other proteins in same PDB: d1fb3a1, d1fb3b1

Details for d1fb3a2

PDB Entry: 1fb3 (more details), 2.5 Å

PDB Description: crystal structure analysis of the ferredoxin-nadp+ reductase from paprika

SCOP Domain Sequences for d1fb3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fb3a2 c.25.1.1 (A:208-362) Ferredoxin reductase (flavodoxin reductase) {Paprika (Capsicum annuum)}
dpnatvimlgtgtgiapfrsflwkmffekhddykfnglawlflgvptsssllykeefekm
kekapenfrldfavsreqtnekgekmyiqtrmaqyaeelwtllkkdntfvymcglkgmeq
giddimsslaakegidwadykkqlkkaeqwnvevy

SCOP Domain Coordinates for d1fb3a2 are not available.

Timeline for d1fb3a2:

Domains from same chain:
(mouse over for more information)
d1fb3a1
Domains from other chains:
(mouse over for more information)
d1fb3b1, d1fb3b2