SCOPe 2.06: Domain d5in7a_: 5in7 A:

Lineage for d5in7a_ (5in7 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.11: Doublecortin (DC) [89837] (1 family)
   possibly related to the ubiquitin-like superfamily

5. Family d.15.11.1: Doublecortin (DC) [89838] (3 proteins)

6. Protein automated matches [190522] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187480] (5 PDB entries)

8. Domain d5in7a_: 5in7 A: [315308]
   automated match to d1mfwa_

Details for d5in7a_

PDB Entry: 5in7, 2.48 Å

PDB Description: x-ray structure of the n-terminal domain of human doublecortin

PDB Compounds: (A:) neuronal migration protein doublecortin

SCOPe Domain Sequences for d5in7a_:

Sequence; same for both SEQRES and ATOM records:

>d5in7a_ d.15.11.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kakkvrfyrngdryfkgivyavssdrfrsfdalladltrslsdninlpqgvryiytidgs
rkigsmdeleegesyvcssdnffddveytknvnpnwsvnv

Timeline for d5in7a_:

• d5in7a_ is new in SCOPe 2.06-stable
  
• d5in7a_ appears in SCOPe 2.07
  
• d5in7a_ appears in the current release, SCOPe 2.08