Lineage for d5corc_ (5cor C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2175338Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2175339Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2175340Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 2175656Protein automated matches [190403] (3 species)
    not a true protein
  7. 2175657Species Human (Homo sapiens) [TaxId:9606] [187277] (23 PDB entries)
  8. 2175689Domain d5corc_: 5cor C: [315305]
    automated match to d4ra8b_
    complexed with act, hez

Details for d5corc_

PDB Entry: 5cor (more details), 2.55 Å

PDB Description: x-ray structure of macrophage inflammatory protein-1 alpha (ccl3) n- terminal-switch polymer
PDB Compounds: (C:) C-C motif chemokine 3

SCOPe Domain Sequences for d5corc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5corc_ d.9.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aadtptaccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvqkyv
sdlelsa

SCOPe Domain Coordinates for d5corc_:

Click to download the PDB-style file with coordinates for d5corc_.
(The format of our PDB-style files is described here.)

Timeline for d5corc_: