![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (24 species) not a true protein |
![]() | Species Vicugna pacos [TaxId:30538] [189756] (82 PDB entries) |
![]() | Domain d5ivoa_: 5ivo A: [315295] automated match to d4grwe_ complexed with mpd |
PDB Entry: 5ivo (more details), 1.8 Å
SCOPe Domain Sequences for d5ivoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ivoa_ b.1.1.1 (A:) automated matches {Vicugna pacos [TaxId: 30538]} qlvesggglvqpggsltlsctasgftldhydigwfrqapgkeregvscinnsdddtyyad svkgrftifmnnakdtvylqmnslkpedtaiyycaeargckrgryeydfwgqgtqvtvss
Timeline for d5ivoa_: