Lineage for d5iixa2 (5iix A:196-387)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2013466Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 2013467Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 2013840Family a.126.1.0: automated matches [254216] (1 protein)
    not a true family
  6. 2013841Protein automated matches [254493] (6 species)
    not a true protein
  7. 2013886Species Horse (Equus caballus) [TaxId:9796] [256129] (14 PDB entries)
  8. 2013909Domain d5iixa2: 5iix A:196-387 [315292]
    automated match to d1hk5a2
    complexed with so4, unl, zn

Details for d5iixa2

PDB Entry: 5iix (more details), 2.2 Å

PDB Description: crystal structure of equine serum albumin in the presence of 15 mm zinc at ph 6.5
PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d5iixa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iixa2 a.126.1.0 (A:196-387) automated matches {Horse (Equus caballus) [TaxId: 9796]}
rlkcssfqnfgeravkawsvarlsqkfpkadfaevskivtdltkvhkecchgdllecadd
radlakyicehqdsisgklkaccdkpllqkshciaevkeddlpsdlpalaadfaedkeic
khykdakdvflgtflyeysrrhpdysvslllriaktyeatlekccaeadppacyrtvfdq
ftplveepkslv

SCOPe Domain Coordinates for d5iixa2:

Click to download the PDB-style file with coordinates for d5iixa2.
(The format of our PDB-style files is described here.)

Timeline for d5iixa2: