Lineage for d1qgab2 (1qga B:654-808)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 120976Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
  4. 120977Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) (S)
  5. 120978Family c.25.1.1: Reductases [52344] (4 proteins)
  6. 120985Protein Ferredoxin reductase (flavodoxin reductase) [52345] (8 species)
  7. 121004Species Garden pea (Pisum sativum) [TaxId:3888] [52347] (4 PDB entries)
  8. 121010Domain d1qgab2: 1qga B:654-808 [31528]
    Other proteins in same PDB: d1qgaa1, d1qgab1

Details for d1qgab2

PDB Entry: 1qga (more details), 2 Å

PDB Description: pea fnr y308w mutant in complex with nadp+

SCOP Domain Sequences for d1qgab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qgab2 c.25.1.1 (B:654-808) Ferredoxin reductase (flavodoxin reductase) {Garden pea (Pisum sativum)}
dpnatvimlgtgtgiapfrsflwkmffekhedyqfnglawlflgvptsssllykeefekm
kekapenfrldfavsreqvndkgekmyiqtrmaqyaeelwellkkdntfvymcglkgmek
giddimvslaakdgidwieykrtlkkaeqwnvevw

SCOP Domain Coordinates for d1qgab2:

Click to download the PDB-style file with coordinates for d1qgab2.
(The format of our PDB-style files is described here.)

Timeline for d1qgab2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qgab1