Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.9: IL8-like [54116] (2 superfamilies) beta(3)-alpha |
Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) form dimers with different dimerisation modes |
Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins) |
Protein RANTES (regulated upon activation, normal T-cell expressed and secreted) [54132] (2 species) has different dimerisation mode |
Species Human (Homo sapiens) [TaxId:9606] [54133] (19 PDB entries) Uniprot P13501 25-91 |
Domain d5dnfi_: 5dnf I: [315273] automated match to d1u4lb_ complexed with bgc, cl, gla, so4, trs |
PDB Entry: 5dnf (more details), 2.55 Å
SCOPe Domain Sequences for d5dnfi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5dnfi_ d.9.1.1 (I:) RANTES (regulated upon activation, normal T-cell expressed and secreted) {Human (Homo sapiens) [TaxId: 9606]} ssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvreyin slems
Timeline for d5dnfi_: