![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) ![]() |
![]() | Family d.15.6.0: automated matches [227139] (1 protein) not a true family |
![]() | Protein automated matches [226841] (5 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:426430] [267924] (2 PDB entries) |
![]() | Domain d5i4db2: 5i4d B:256-356 [315270] Other proteins in same PDB: d5i4da1, d5i4db1 automated match to d4dxga2 complexed with fuc, gal, nag, ndg, pg4, pge, sia |
PDB Entry: 5i4d (more details), 1.75 Å
SCOPe Domain Sequences for d5i4db2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5i4db2 d.15.6.0 (B:256-356) automated matches {Staphylococcus aureus [TaxId: 426430]} kvnhkvelsitkkdnqgmisrdvseymitkeeislkeldfklrkqliekhnlygnmgsgt ivikmknggkytfelhkklqehrmadvidgtnidnievnik
Timeline for d5i4db2: