SCOPe 2.07: Domain d5ig1a_: 5ig1 A:

Lineage for d5ig1a_ (5ig1 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.0: automated matches [191359] (1 protein)
   not a true family

6. Protein automated matches [190417] (35 species)
   not a true protein

7. Species Salpingoeca rosetta [TaxId:946362] [315245] (1 PDB entry)

8. Domain d5ig1a_: 5ig1 A: [315246]
   automated match to d2bdwb_
   complexed with po4

Details for d5ig1a_

PDB Entry: 5ig1, 2.9 Å

PDB Description: crystal structure of s. rosetta camkii kinase domain

PDB Compounds: (A:) CAMK/CAMK2 protein kinase

SCOPe Domain Sequences for d5ig1a_:

Sequence; same for both SEQRES and ATOM records:

>d5ig1a_ d.144.1.0 (A:) automated matches {Salpingoeca rosetta [TaxId: 946362]}
metetsffdlydvdlkdkrsvigkgafstvhrcvnkrtgevcavkvialkslrsseinki
kreigicsslqhehivsmrrafrdeshfylvfeyvsggelfdeivtrkfynekdasacmh
qilsalqhchskniihrdlkpenlllaskdpnapvkitdfglavimeqgptyfgfagtpg
ylspevirrvpydtavdvwacgvilyillvgyppfweedhqklyaqikncqydfpspewd
svttaakelikamlepnpkrrptvqellqhpwiarrdvpgsvhrqatleelkkfnarrkl

Timeline for d5ig1a_:

• d5ig1a_ first appeared in SCOPe 2.06
  
• d5ig1a_ appears in the current release, SCOPe 2.08