Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (35 species) not a true protein |
Species Salpingoeca rosetta [TaxId:946362] [315245] (1 PDB entry) |
Domain d5ig1a_: 5ig1 A: [315246] automated match to d2bdwb_ complexed with po4 |
PDB Entry: 5ig1 (more details), 2.9 Å
SCOPe Domain Sequences for d5ig1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ig1a_ d.144.1.0 (A:) automated matches {Salpingoeca rosetta [TaxId: 946362]} metetsffdlydvdlkdkrsvigkgafstvhrcvnkrtgevcavkvialkslrsseinki kreigicsslqhehivsmrrafrdeshfylvfeyvsggelfdeivtrkfynekdasacmh qilsalqhchskniihrdlkpenlllaskdpnapvkitdfglavimeqgptyfgfagtpg ylspevirrvpydtavdvwacgvilyillvgyppfweedhqklyaqikncqydfpspewd svttaakelikamlepnpkrrptvqellqhpwiarrdvpgsvhrqatleelkkfnarrkl
Timeline for d5ig1a_: