Lineage for d5if0l1 (5if0 L:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2756400Domain d5if0l1: 5if0 L:1-107 [315243]
    Other proteins in same PDB: d5if0b2, d5if0l2
    automated match to d1n0xl1
    complexed with nag, po4

Details for d5if0l1

PDB Entry: 5if0 (more details), 2.44 Å

PDB Description: crystal structure of vrc01c-hugl2 fab from an hiv-1 naive donor in complex with with a germline-targeting gp120 engineered outer domain eod-gt8 at 2.44 a
PDB Compounds: (L:) VRC01c-HuGL2 Fab light chain

SCOPe Domain Sequences for d5if0l1:

Sequence, based on SEQRES records: (download)

>d5if0l1 b.1.1.0 (L:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqspdslavslgeratinckssqsvlyssnnknylawyqqkpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyycqqyysfgggtkveik

Sequence, based on observed residues (ATOM records): (download)

>d5if0l1 b.1.1.0 (L:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqspdslavslgeratinckssqknylawyqqkpgqppklliywastresgvpdrf
sgsgsgtdftltisslqaedvavyycqqyysfgggtkveik

SCOPe Domain Coordinates for d5if0l1:

Click to download the PDB-style file with coordinates for d5if0l1.
(The format of our PDB-style files is described here.)

Timeline for d5if0l1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5if0l2