SCOPe 2.08: Domain d5an4a2: 5an4 A:136-323

Lineage for d5an4a2 (5an4 A:136-323)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.96: DNA-glycosylase [48149] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.96.1: DNA-glycosylase [48150] (7 families)

5. Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (3 proteins)

6. Protein automated matches [227058] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226066] (2 PDB entries)

8. Domain d5an4a2: 5an4 A:136-323 [315234]
   Other proteins in same PDB: d5an4a1
   automated match to d1ko9a1
   complexed with so4

Details for d5an4a2

PDB Entry: 5an4, 1.6 Å

PDB Description: crystal structure of the human 8-oxoguanine glycosylase (ogg1) processed with the crystaldirect automated mounting and cryo-cooling technology

PDB Compounds: (A:) N-glycosylase/DNA lyase

SCOPe Domain Sequences for d5an4a2:

Sequence; same for both SEQRES and ATOM records:

>d5an4a2 a.96.1.3 (A:136-323) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpieclfsficssnnniaritgmverlcqafgprliqlddvtyhgfpslqalagpeveah
lrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgtkvadcic
lmaldkpqavpvdvhmwhiaqrdyswhpttsqakgpspqtnkelgnffrslwgpyagwaq
avlfsadl

Timeline for d5an4a2:

• d5an4a2 first appeared in SCOPe 2.06
  
• d5an4a2 appears in SCOPe 2.07