Lineage for d5io5a_ (5io5 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804248Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2804271Protein beta-Lactoglobulin [50827] (4 species)
  7. 2804272Species Cow (Bos taurus) [TaxId:9913] [50828] (76 PDB entries)
    Uniprot P02754
  8. 2804356Domain d5io5a_: 5io5 A: [315230]
    automated match to d1bsqa_
    complexed with cl

Details for d5io5a_

PDB Entry: 5io5 (more details), 2.85 Å

PDB Description: unliganded form of bovine beta-lactoglobulin, ambient pressure
PDB Compounds: (A:) beta-lactoglobulin

SCOPe Domain Sequences for d5io5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5io5a_ b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]}
livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
wengecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacq
clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi

SCOPe Domain Coordinates for d5io5a_:

Click to download the PDB-style file with coordinates for d5io5a_.
(The format of our PDB-style files is described here.)

Timeline for d5io5a_: