SCOP 1.73: Domain d1qfza2: 1qfz A:154-308

Lineage for d1qfza2 (1qfz A:154-308)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families)
   binds NADP differently than classical Rossmann-fold
   N-terminal FAD-linked domain contains (6,10) barrel

5. Family c.25.1.1: Reductases [52344] (4 proteins)

6. Protein Ferredoxin reductase (flavodoxin reductase) [52345] (8 species)

7. Species Garden pea (Pisum sativum) [TaxId:3888] [52347] (4 PDB entries)

8. Domain d1qfza2: 1qfz A:154-308 [31523]
   Other proteins in same PDB: d1qfza1, d1qfzb1

Details for d1qfza2

PDB Entry: 1qfz, 1.7 Å

PDB Description: pea fnr y308s mutant in complex with nadph

PDB Compounds: (A:) protein (ferredoxin:nadp+ reductase)

SCOP Domain Sequences for d1qfza2:

Sequence; same for both SEQRES and ATOM records:

>d1qfza2 c.25.1.1 (A:154-308) Ferredoxin reductase (flavodoxin reductase) {Garden pea (Pisum sativum) [TaxId: 3888]}
dpnatvimlgtgtgiapfrsflwkmffekhedyqfnglawlflgvptsssllykeefekm
kekapenfrldfavsreqvndkgekmyiqtrmaqyaeelwellkkdntfvymcglkgmek
giddimvslaakdgidwieykrtlkkaeqwnvevs

Timeline for d1qfza2:

• d1qfza2 first appeared (with stable ids) in SCOP 1.55
  
• d1qfza2 appears in SCOP 1.71
  
• d1qfza2 appears in SCOP 1.75
  
• d1qfza2 appears in the current release, SCOPe 2.08