SCOP 1.71: Domain d1frqa2: 1frq A:155-314

Lineage for d1frqa2 (1frq A:155-314)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families)
   binds NADP differently than classical Rossmann-fold
   N-terminal FAD-linked domain contains (6,10) barrel

5. Family c.25.1.1: Reductases [52344] (4 proteins)

6. Protein Ferredoxin reductase (flavodoxin reductase) [52345] (8 species)

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [52346] (7 PDB entries)

8. Domain d1frqa2: 1frq A:155-314 [31522]
   Other proteins in same PDB: d1frqa1
   complexed with fad, po4, so4; mutant

Details for d1frqa2

PDB Entry: 1frq, 1.95 Å

PDB Description: ferredoxin:nadp+ oxidoreductase (ferredoxin reductase) mutant e312a

SCOP Domain Sequences for d1frqa2:

Sequence; same for both SEQRES and ATOM records:

>d1frqa2 c.25.1.1 (A:155-314) Ferredoxin reductase (flavodoxin reductase) {Spinach (Spinacia oleracea)}
mlmpkdpnatiimlgtgtgiapfrsflwkmffekhddykfnglawlflgvptsssllyke
efekmkekapdnfrldfavsreqtnekgekmyiqtrmaqyavelwemlkkdntyfymcgl
kgmekgiddimvslaaaegidwieykrqlkkaeqwnvavy

Timeline for d1frqa2:

• d1frqa2 first appeared (with stable ids) in SCOP 1.55
  
• d1frqa2 appears in SCOP 1.69
  
• d1frqa2 appears in SCOP 1.73
  
• d1frqa2 appears in the current release, SCOPe 2.08