![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
![]() | Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
![]() | Protein automated matches [190115] (76 species) not a true protein |
![]() | Species Streptococcus suis [TaxId:423211] [315210] (2 PDB entries) |
![]() | Domain d5dbue_: 5dbu E: [315216] automated match to d3ndoa_ |
PDB Entry: 5dbu (more details), 2.8 Å
SCOPe Domain Sequences for d5dbue_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5dbue_ c.1.10.0 (E:) automated matches {Streptococcus suis [TaxId: 423211]} lnkyidhtilkpettqeqvekilaeakeydfasvcvnptwvalaaeslkdsdvkvctvig fplgantpavkafetkdaisngadeidmvinigalktgnydlvledikavvaasgdklvk viieaclltddekvkacqlsqeagadyvktstgfstggatvadvalmrktvgpdmgvkas ggarsyedaiafieagasrigassgvaim
Timeline for d5dbue_: