| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
| Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
| Protein automated matches [190115] (94 species) not a true protein |
| Species Streptococcus suis [TaxId:423211] [315210] (2 PDB entries) |
| Domain d5dbtf_: 5dbt F: [315211] automated match to d1ub3b_ |
PDB Entry: 5dbt (more details), 2.81 Å
SCOPe Domain Sequences for d5dbtf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5dbtf_ c.1.10.0 (F:) automated matches {Streptococcus suis [TaxId: 423211]}
mklnkyidhtilkpettqeqvekilaeakeydfasvcvnptwvalaaeslkdsdvkvctv
igfplgantpavkafetkdaisngadeidmvinigalktgnydlvledikavvaasgdkl
vkviieaclltddekvkacqlsqeagadyvktstgfstggatvadvalmrktvgpdmgvk
asggarsyedaiafieagasr
Timeline for d5dbtf_: