Lineage for d5dbtf_ (5dbt F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835965Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2835966Protein automated matches [190115] (94 species)
    not a true protein
  7. 2836666Species Streptococcus suis [TaxId:423211] [315210] (2 PDB entries)
  8. 2836672Domain d5dbtf_: 5dbt F: [315211]
    automated match to d1ub3b_

Details for d5dbtf_

PDB Entry: 5dbt (more details), 2.81 Å

PDB Description: crystal structure of c-terminal truncated 2-deoxyribose-5-phosphate aldolase (1-201) from streptococcus suis
PDB Compounds: (F:) deoxyribose-phosphate aldolase

SCOPe Domain Sequences for d5dbtf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dbtf_ c.1.10.0 (F:) automated matches {Streptococcus suis [TaxId: 423211]}
mklnkyidhtilkpettqeqvekilaeakeydfasvcvnptwvalaaeslkdsdvkvctv
igfplgantpavkafetkdaisngadeidmvinigalktgnydlvledikavvaasgdkl
vkviieaclltddekvkacqlsqeagadyvktstgfstggatvadvalmrktvgpdmgvk
asggarsyedaiafieagasr

SCOPe Domain Coordinates for d5dbtf_:

Click to download the PDB-style file with coordinates for d5dbtf_.
(The format of our PDB-style files is described here.)

Timeline for d5dbtf_: