Lineage for d1frn_2 (1frn 155-314)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 68846Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
  4. 68847Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) (S)
  5. 68848Family c.25.1.1: Reductases [52344] (4 proteins)
  6. 68852Protein Ferredoxin reductase (flavodoxin reductase) [52345] (8 species)
  7. 68886Species Spinach (Spinacia oleracea) [TaxId:3562] [52346] (7 PDB entries)
  8. 68892Domain d1frn_2: 1frn 155-314 [31521]
    Other proteins in same PDB: d1frn_1

Details for d1frn_2

PDB Entry: 1frn (more details), 2 Å

PDB Description: the involvement of ser96 in the catalytic mechanism of ferredoxin-nadp+ reductase: structure-function relationship as studied by site-directed mutagenesis and x-ray crystallography

SCOP Domain Sequences for d1frn_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1frn_2 c.25.1.1 (155-314) Ferredoxin reductase (flavodoxin reductase) {Spinach (Spinacia oleracea)}
mlmpkdpnatiimlgtgtgiapfrsflwkmffekhddykfnglawlflgvptsssllyke
efekmkekapdnfrldfavsreqtnekgekmyiqtrmaqyavelwemlkkdntyfymcgl
kgmekgiddimvslaaaegidwieykrqlkkaeqwnvevy

SCOP Domain Coordinates for d1frn_2:

Click to download the PDB-style file with coordinates for d1frn_2.
(The format of our PDB-style files is described here.)

Timeline for d1frn_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1frn_1