Lineage for d1frn_2 (1frn 155-314)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) 
Family c.25.1.1: Reductases [52344] (4 proteins) Protein Ferredoxin reductase (flavodoxin reductase) [52345] (7 species) 
Species Spinach (Spinacia oleracea) [TaxId:3562] [52346] (7 PDB entries) 
Domain d1frn_2: 1frn 155-314 [31521]
Other proteins in same PDB: d1frn_1
Details for d1frn_2
PDB Entry: 1frn (more details), 2 Å
PDB Description: the involvement of ser96 in the catalytic mechanism of ferredoxin-nadp+ reductase: structure-function relationship as studied by site-directed mutagenesis and x-ray crystallography
SCOP Domain Sequences for d1frn_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1frn_2 c.25.1.1 (155-314) Ferredoxin reductase (flavodoxin reductase) {Spinach (Spinacia oleracea)}
mlmpkdpnatiimlgtgtgiapfrsflwkmffekhddykfnglawlflgvptsssllyke
efekmkekapdnfrldfavsreqtnekgekmyiqtrmaqyavelwemlkkdntyfymcgl
kgmekgiddimvslaaaegidwieykrqlkkaeqwnvevy
SCOP Domain Coordinates for d1frn_2:
Click to download the PDB-style file with coordinates for d1frn_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1frn_2:
- d1frn_2 appears in SCOP 1.57
- d1frn_2 appears in the current release, SCOPe 2.08, called d1frna2
View in 3D
