Lineage for d5a5ea3 (5a5e A:298-437)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890898Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest
  4. 2890899Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (3 families) (S)
  5. 2890900Family c.59.1.1: MurCDEF C-terminal domain [53245] (4 proteins)
  6. 2890917Protein UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD [53246] (1 species)
  7. 2890918Species Escherichia coli [TaxId:562] [53247] (7 PDB entries)
  8. 2890922Domain d5a5ea3: 5a5e A:298-437 [315199]
    Other proteins in same PDB: d5a5ea1, d5a5ea2
    automated match to d2uaga2
    complexed with mpd, ni, so4

Details for d5a5ea3

PDB Entry: 5a5e (more details), 1.84 Å

PDB Description: crystal structure of murd ligase from escherichia coli
PDB Compounds: (A:) udp-n-acetylmuramoylalanine--d-glutamate ligase

SCOPe Domain Sequences for d5a5ea3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a5ea3 c.59.1.1 (A:298-437) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]}
glphrfevvlehngvrwindskatnvgsteaalnglhvdgtlhlllggdgksadfsplar
ylngdnvrlycfgrdgaqlaalrpevaeqtetmeqamrllaprvqpgdmvllspacasld
qfknfeqrgnefarlakelg

SCOPe Domain Coordinates for d5a5ea3:

Click to download the PDB-style file with coordinates for d5a5ea3.
(The format of our PDB-style files is described here.)

Timeline for d5a5ea3: