Lineage for d5a5ea1 (5a5e A:1-93)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2433922Fold c.5: MurCD N-terminal domain [51983] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group
  4. 2433923Superfamily c.5.1: MurCD N-terminal domain [51984] (2 families) (S)
  5. 2433924Family c.5.1.1: MurCD N-terminal domain [51985] (2 protein domains)
  6. 2433937Protein UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD [51986] (1 species)
  7. 2433938Species Escherichia coli [TaxId:562] [51987] (7 PDB entries)
  8. 2433944Domain d5a5ea1: 5a5e A:1-93 [315197]
    Other proteins in same PDB: d5a5ea2, d5a5ea3
    automated match to d2uaga1
    complexed with mpd, ni, so4

Details for d5a5ea1

PDB Entry: 5a5e (more details), 1.84 Å

PDB Description: crystal structure of murd ligase from escherichia coli
PDB Compounds: (A:) udp-n-acetylmuramoylalanine--d-glutamate ligase

SCOPe Domain Sequences for d5a5ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a5ea1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]}
adyqgknvviiglgltglscvdfflargvtprvmdtrmtppgldklpeaverhtgslnde
wlmaadlivaspgialahpslsaaadagieivg

SCOPe Domain Coordinates for d5a5ea1:

Click to download the PDB-style file with coordinates for d5a5ea1.
(The format of our PDB-style files is described here.)

Timeline for d5a5ea1: