Lineage for d1bx1a2 (1bx1 A:155-314)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 579859Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 579860Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 579861Family c.25.1.1: Reductases [52344] (4 proteins)
  6. 579872Protein Ferredoxin reductase (flavodoxin reductase) [52345] (8 species)
  7. 579917Species Spinach (Spinacia oleracea) [TaxId:3562] [52346] (7 PDB entries)
  8. 579921Domain d1bx1a2: 1bx1 A:155-314 [31519]
    Other proteins in same PDB: d1bx1a1
    complexed with fad, po4, so4; mutant

Details for d1bx1a2

PDB Entry: 1bx1 (more details), 1.9 Å

PDB Description: ferredoxin:nadp+ oxidoreductase (ferredoxin reductase) mutant e312q

SCOP Domain Sequences for d1bx1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bx1a2 c.25.1.1 (A:155-314) Ferredoxin reductase (flavodoxin reductase) {Spinach (Spinacia oleracea)}
mlmpkdpnatiimlgtgtgiapfrsflwkmffekhddykfnglawlflgvptsssllyke
efekmkekapdnfrldfavsreqtnekgekmyiqtrmaqyavelwemlkkdntyfymcgl
kgmekgiddimvslaaaegidwieykrqlkkaeqwnvqvy

SCOP Domain Coordinates for d1bx1a2:

Click to download the PDB-style file with coordinates for d1bx1a2.
(The format of our PDB-style files is described here.)

Timeline for d1bx1a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bx1a1