Lineage for d1bx1a2 (1bx1 A:155-314)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) 
Family c.25.1.1: Reductases [52344] (4 proteins) Protein Ferredoxin reductase (flavodoxin reductase) [52345] (8 species) 
Species Spinach (Spinacia oleracea) [TaxId:3562] [52346] (7 PDB entries) 
Domain d1bx1a2: 1bx1 A:155-314 [31519]
Other proteins in same PDB: d1bx1a1
Details for d1bx1a2
PDB Entry: 1bx1 (more details), 1.9 Å
PDB Description: ferredoxin:nadp+ oxidoreductase (ferredoxin reductase) mutant e312q
SCOP Domain Sequences for d1bx1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bx1a2 c.25.1.1 (A:155-314) Ferredoxin reductase (flavodoxin reductase) {Spinach (Spinacia oleracea)}
mlmpkdpnatiimlgtgtgiapfrsflwkmffekhddykfnglawlflgvptsssllyke
efekmkekapdnfrldfavsreqtnekgekmyiqtrmaqyavelwemlkkdntyfymcgl
kgmekgiddimvslaaaegidwieykrqlkkaeqwnvqvy
SCOP Domain Coordinates for d1bx1a2:
Click to download the PDB-style file with coordinates for d1bx1a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bx1a2:
- d1bx1a2 first appeared (with stable ids) in SCOP 1.55
- d1bx1a2 appears in SCOP 1.57
- d1bx1a2 appears in SCOP 1.61
- d1bx1a2 appears in the current release, SCOPe 2.08
View in 3D
