Lineage for d1bx1a2 (1bx1 A:155-314)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22422Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
  4. 22423Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) (S)
  5. 22424Family c.25.1.1: Reductases [52344] (4 proteins)
  6. 22428Protein Ferredoxin reductase (flavodoxin reductase) [52345] (7 species)
  7. 22457Species Spinach (Spinacia oleracea) [TaxId:3562] [52346] (7 PDB entries)
  8. 22461Domain d1bx1a2: 1bx1 A:155-314 [31519]
    Other proteins in same PDB: d1bx1a1

Details for d1bx1a2

PDB Entry: 1bx1 (more details), 1.9 Å

PDB Description: ferredoxin:nadp+ oxidoreductase (ferredoxin reductase) mutant e312q

SCOP Domain Sequences for d1bx1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bx1a2 c.25.1.1 (A:155-314) Ferredoxin reductase (flavodoxin reductase) {Spinach (Spinacia oleracea)}
mlmpkdpnatiimlgtgtgiapfrsflwkmffekhddykfnglawlflgvptsssllyke
efekmkekapdnfrldfavsreqtnekgekmyiqtrmaqyavelwemlkkdntyfymcgl
kgmekgiddimvslaaaegidwieykrqlkkaeqwnvqvy

SCOP Domain Coordinates for d1bx1a2:

Click to download the PDB-style file with coordinates for d1bx1a2.
(The format of our PDB-style files is described here.)

Timeline for d1bx1a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bx1a1