Lineage for d5hs3d1 (5hs3 D:26-306)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2212073Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2212074Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2212075Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2212113Protein Thymidylate synthase [55833] (7 species)
  7. 2212254Species Human (Homo sapiens) [TaxId:9606] [55840] (26 PDB entries)
  8. 2212320Domain d5hs3d1: 5hs3 D:26-306 [315185]
    Other proteins in same PDB: d5hs3a2, d5hs3b2, d5hs3c2, d5hs3d2, d5hs3e2, d5hs3f2
    automated match to d1hvya_
    complexed with ki3, ump

Details for d5hs3d1

PDB Entry: 5hs3 (more details), 3.1 Å

PDB Description: human thymidylate synthase complexed with dump and 3-amino-2-benzoyl- 4-methylthieno[2,3-b]pyridin-6-ol
PDB Compounds: (D:) Thymidylate synthase

SCOPe Domain Sequences for d5hs3d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hs3d1 d.117.1.1 (D:26-306) Thymidylate synthase {Human (Homo sapiens) [TaxId: 9606]}
pphgelqylgqiqhilrcgvrkddrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvl
eellwfikgstnakelsskgvkiwdangsrdfldslgfstreegdlgpvygfqwrhfgae
yrdmesdysgqgvdqlqrvidtiktnpddrriimcawnprdlplmalppchalcqfyvvn
selscqlyqrsgdmglgvpfniasyalltymiahitglkpgdfihtlgdahiylnhiepl
kiqlqreprpfpklrilrkvekiddfkaedfqiegynphpt

SCOPe Domain Coordinates for d5hs3d1:

Click to download the PDB-style file with coordinates for d5hs3d1.
(The format of our PDB-style files is described here.)

Timeline for d5hs3d1: