Lineage for d1fnba2 (1fnb A:155-314)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2467994Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2467995Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 2467996Family c.25.1.1: Reductases [52344] (5 proteins)
  6. 2468015Protein Ferredoxin reductase (flavodoxin reductase) [52345] (9 species)
  7. 2468065Species Spinach (Spinacia oleracea) [TaxId:3562] [52346] (7 PDB entries)
  8. 2468067Domain d1fnba2: 1fnb A:155-314 [31518]
    Other proteins in same PDB: d1fnba1
    complexed with fad, po4, so4

Details for d1fnba2

PDB Entry: 1fnb (more details), 1.7 Å

PDB Description: refined crystal structure of spinach ferredoxin reductase at 1.7 angstroms resolution: oxidized, reduced, and 2'-phospho-5'-amp bound states
PDB Compounds: (A:) ferredoxin-nadp+ reductase

SCOPe Domain Sequences for d1fnba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnba2 c.25.1.1 (A:155-314) Ferredoxin reductase (flavodoxin reductase) {Spinach (Spinacia oleracea) [TaxId: 3562]}
mlmpkdpnatiimlgtgtgiapfrsflwkmffekhddykfnglawlflgvptsssllyke
efekmkekapdnfrldfavsreqtnekgekmyiqtrmaqyavelwemlkkdntyvymcgl
kgmekgiddimvslaaaegidwieykrqlkkaeqwnvevy

SCOPe Domain Coordinates for d1fnba2:

Click to download the PDB-style file with coordinates for d1fnba2.
(The format of our PDB-style files is described here.)

Timeline for d1fnba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fnba1