SCOPe 2.06: Domain d1fnba2: 1fnb A:155-314

Lineage for d1fnba2 (1fnb A:155-314)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families)
   binds NADP differently than classical Rossmann-fold
   N-terminal FAD-linked domain contains (6,10) barrel

5. Family c.25.1.1: Reductases [52344] (5 proteins)

6. Protein Ferredoxin reductase (flavodoxin reductase) [52345] (9 species)

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [52346] (7 PDB entries)

8. Domain d1fnba2: 1fnb A:155-314 [31518]
   Other proteins in same PDB: d1fnba1
   complexed with fad, po4, so4

Details for d1fnba2

PDB Entry: 1fnb, 1.7 Å

PDB Description: refined crystal structure of spinach ferredoxin reductase at 1.7 angstroms resolution: oxidized, reduced, and 2'-phospho-5'-amp bound states

PDB Compounds: (A:) ferredoxin-nadp+ reductase

SCOPe Domain Sequences for d1fnba2:

Sequence; same for both SEQRES and ATOM records:

>d1fnba2 c.25.1.1 (A:155-314) Ferredoxin reductase (flavodoxin reductase) {Spinach (Spinacia oleracea) [TaxId: 3562]}
mlmpkdpnatiimlgtgtgiapfrsflwkmffekhddykfnglawlflgvptsssllyke
efekmkekapdnfrldfavsreqtnekgekmyiqtrmaqyavelwemlkkdntyvymcgl
kgmekgiddimvslaaaegidwieykrqlkkaeqwnvevy

Timeline for d1fnba2:

• d1fnba2 first appeared (with stable ids) in SCOP 1.55, called d1fnb_2
  
• d1fnba2 appears in SCOPe 2.05
  
• d1fnba2 appears in SCOPe 2.07
  
• d1fnba2 appears in the current release, SCOPe 2.08