Lineage for d1fnb_2 (1fnb 155-314)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 482261Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 482262Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 482263Family c.25.1.1: Reductases [52344] (4 proteins)
  6. 482272Protein Ferredoxin reductase (flavodoxin reductase) [52345] (8 species)
  7. 482317Species Spinach (Spinacia oleracea) [TaxId:3562] [52346] (7 PDB entries)
  8. 482319Domain d1fnb_2: 1fnb 155-314 [31518]
    Other proteins in same PDB: d1fnb_1

Details for d1fnb_2

PDB Entry: 1fnb (more details), 1.7 Å

PDB Description: refined crystal structure of spinach ferredoxin reductase at 1.7 angstroms resolution: oxidized, reduced, and 2'-phospho-5'-amp bound states

SCOP Domain Sequences for d1fnb_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnb_2 c.25.1.1 (155-314) Ferredoxin reductase (flavodoxin reductase) {Spinach (Spinacia oleracea)}
mlmpkdpnatiimlgtgtgiapfrsflwkmffekhddykfnglawlflgvptsssllyke
efekmkekapdnfrldfavsreqtnekgekmyiqtrmaqyavelwemlkkdntyvymcgl
kgmekgiddimvslaaaegidwieykrqlkkaeqwnvevy

SCOP Domain Coordinates for d1fnb_2:

Click to download the PDB-style file with coordinates for d1fnb_2.
(The format of our PDB-style files is described here.)

Timeline for d1fnb_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fnb_1