Lineage for d5in3b1 (5in3 B:22-197)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2929711Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 2929712Superfamily d.13.1: HIT-like [54197] (6 families) (S)
  5. 2929896Family d.13.1.2: Hexose-1-phosphate uridylyltransferase [54207] (1 protein)
    duplication: consists of 2 HIT-like motifs
    binds zinc and iron ions
  6. 2929897Protein Galactose-1-phosphate uridylyltransferase [54208] (3 species)
  7. 2929923Species Human (Homo sapiens) [TaxId:9606] [315092] (2 PDB entries)
  8. 2929926Domain d5in3b1: 5in3 B:22-197 [315175]
    automated match to d1guqa1
    complexed with edo, g1p, h2u, zn

Details for d5in3b1

PDB Entry: 5in3 (more details), 1.73 Å

PDB Description: crystal structure of glucose-1-phosphate bound nucleotidylated human galactose-1-phosphate uridylyltransferase
PDB Compounds: (B:) galactose-1-phosphate uridylyltransferase

SCOPe Domain Sequences for d5in3b1:

Sequence, based on SEQRES records: (download)

>d5in3b1 d.13.1.2 (B:22-197) Galactose-1-phosphate uridylyltransferase {Human (Homo sapiens) [TaxId: 9606]}
atfrandhqhirynplqdewvlvsahrmkrpwqgqvepqllktvprhdplnplcpgaira
ngevnpqydstflfdndfpalqpdapspgpsdhplfqaksargvckvmcfhpwsdvtlpl
msvpeiravvdawasvteelgaqypwvqifenkgammgcsnphphcqvwassflpd

Sequence, based on observed residues (ATOM records): (download)

>d5in3b1 d.13.1.2 (B:22-197) Galactose-1-phosphate uridylyltransferase {Human (Homo sapiens) [TaxId: 9606]}
atfrandhqhirynplqdewvlvsahrtvprhdplnplcpgairangevnpqydstflfd
ndfpalqpdapspgpsdhplfqaksargvckvmcfhpwsdvtlplmsvpeiravvdawas
vteelgaqypwvqifenkgammgcsnphphcqvwassflpd

SCOPe Domain Coordinates for d5in3b1:

Click to download the PDB-style file with coordinates for d5in3b1.
(The format of our PDB-style files is described here.)

Timeline for d5in3b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5in3b2