![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.13: HIT-like [54196] (2 superfamilies) alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha |
![]() | Superfamily d.13.1: HIT-like [54197] (6 families) ![]() |
![]() | Family d.13.1.2: Hexose-1-phosphate uridylyltransferase [54207] (1 protein) duplication: consists of 2 HIT-like motifs binds zinc and iron ions |
![]() | Protein Galactose-1-phosphate uridylyltransferase [54208] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [315092] (2 PDB entries) |
![]() | Domain d5in3b1: 5in3 B:22-197 [315175] automated match to d1guqa1 complexed with edo, g1p, h2u, zn |
PDB Entry: 5in3 (more details), 1.73 Å
SCOPe Domain Sequences for d5in3b1:
Sequence, based on SEQRES records: (download)
>d5in3b1 d.13.1.2 (B:22-197) Galactose-1-phosphate uridylyltransferase {Human (Homo sapiens) [TaxId: 9606]} atfrandhqhirynplqdewvlvsahrmkrpwqgqvepqllktvprhdplnplcpgaira ngevnpqydstflfdndfpalqpdapspgpsdhplfqaksargvckvmcfhpwsdvtlpl msvpeiravvdawasvteelgaqypwvqifenkgammgcsnphphcqvwassflpd
>d5in3b1 d.13.1.2 (B:22-197) Galactose-1-phosphate uridylyltransferase {Human (Homo sapiens) [TaxId: 9606]} atfrandhqhirynplqdewvlvsahrtvprhdplnplcpgairangevnpqydstflfd ndfpalqpdapspgpsdhplfqaksargvckvmcfhpwsdvtlplmsvpeiravvdawas vteelgaqypwvqifenkgammgcsnphphcqvwassflpd
Timeline for d5in3b1: