Lineage for d1fnc_2 (1fnc 155-314)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) 
Family c.25.1.1: Reductases [52344] (4 proteins) Protein Ferredoxin reductase (flavodoxin reductase) [52345] (8 species) 
Species Spinach (Spinacia oleracea) [TaxId:3562] [52346] (7 PDB entries) 
Domain d1fnc_2: 1fnc 155-314 [31517]
Other proteins in same PDB: d1fnc_1
Details for d1fnc_2
PDB Entry: 1fnc (more details), 1.7 Å
PDB Description: refined crystal structure of spinach ferredoxin reductase at 1.7 angstroms resolution: oxidized, reduced, and 2'-phospho-5'-amp bound states
SCOP Domain Sequences for d1fnc_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fnc_2 c.25.1.1 (155-314) Ferredoxin reductase (flavodoxin reductase) {Spinach (Spinacia oleracea)}
mlmpkdpnatiimlgtgtgiapfrsflwkmffekhddykfnglawlflgvptsssllyke
efekmkekapdnfrldfavsreqtnekgekmyiqtrmaqyavelwemlkkdntyvymcgl
kgmekgiddimvslaaaegidwieykrqlkkaeqwnvevy
SCOP Domain Coordinates for d1fnc_2:
Click to download the PDB-style file with coordinates for d1fnc_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fnc_2:
- d1fnc_2 first appeared (with stable ids) in SCOP 1.55
- d1fnc_2 appears in SCOP 1.59
- d1fnc_2 appears in the current release, SCOPe 2.08, called d1fnca2
View in 3D
