![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
![]() | Protein automated matches [190824] (31 species) not a true protein |
![]() | Species Shewanella denitrificans [TaxId:318161] [314881] (3 PDB entries) |
![]() | Domain d5i5mb2: 5i5m B:499-628 [315166] Other proteins in same PDB: d5i5ma1, d5i5ma3, d5i5mb1, d5i5mb3 automated match to d1qnia1 complexed with bu3, ca, so4 |
PDB Entry: 5i5m (more details), 1.37 Å
SCOPe Domain Sequences for d5i5mb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5i5mb2 b.6.1.0 (B:499-628) automated matches {Shewanella denitrificans [TaxId: 318161]} klwtrddpmfadtvamakqdgvtlemdnkvirdgnkvrvymtsiapnfgmnefkvklgde vtvvvtnldqvedvthgfcmtnhgvqmevapqatasvtfiankpgvqwyycnwfchalhm emrgrmlvea
Timeline for d5i5mb2: