SCOPe 2.06: Domain d5iiua1: 5iiu A:3-195

Lineage for d5iiua1 (5iiu A:3-195)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (2 families)

5. Family a.126.1.0: automated matches [254216] (1 protein)
   not a true family

6. Protein automated matches [254493] (6 species)
   not a true protein

7. Species Horse (Equus caballus) [TaxId:9796] [256129] (14 PDB entries)

8. Domain d5iiua1: 5iiu A:3-195 [315161]
   automated match to d1hk5a2
   complexed with so4, zn

Details for d5iiua1

PDB Entry: 5iiu, 2.3 Å

PDB Description: crystal structure of equine serum albumin in the presence of 10 mm zinc at ph 6.9

PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d5iiua1:

Sequence; same for both SEQRES and ATOM records:

>d5iiua1 a.126.1.0 (A:3-195) automated matches {Horse (Equus caballus) [TaxId: 9796]}
hkseiahrfndlgekhfkglvlvafsqylqqcpfedhvklvnevtefakkcaadesaenc
dkslhtlfgdklctvatlratygeladccekqepernecflthkddhpnlpklkpepdaq
caafqedpdkflgkylyevarrhpyfygpellfhaeeykadfteccpaddklaclipkld
alkerillssake

Timeline for d5iiua1:

• d5iiua1 is new in SCOPe 2.06-stable
  
• d5iiua1 appears in SCOPe 2.07
  
• d5iiua1 appears in the current release, SCOPe 2.08