Lineage for d1fnda2 (1fnd A:155-314)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 827305Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 827306Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 827307Family c.25.1.1: Reductases [52344] (4 proteins)
  6. 827318Protein Ferredoxin reductase (flavodoxin reductase) [52345] (8 species)
  7. 827369Species Spinach (Spinacia oleracea) [TaxId:3562] [52346] (7 PDB entries)
  8. 827370Domain d1fnda2: 1fnd A:155-314 [31516]
    Other proteins in same PDB: d1fnda1
    complexed with a2p, fad, so4

Details for d1fnda2

PDB Entry: 1fnd (more details), 1.7 Å

PDB Description: refined crystal structure of spinach ferredoxin reductase at 1.7 angstroms resolution: oxidized, reduced, and 2'-phospho-5'-amp bound states
PDB Compounds: (A:) ferredoxin-nadp+ reductase

SCOP Domain Sequences for d1fnda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnda2 c.25.1.1 (A:155-314) Ferredoxin reductase (flavodoxin reductase) {Spinach (Spinacia oleracea) [TaxId: 3562]}
mlmpkdpnatiimlgtgtgiapfrsflwkmffekhddykfnglawlflgvptsssllyke
efekmkekapdnfrldfavsreqtnekgekmyiqtrmaqyavelwemlkkdntyvymcgl
kgmekgiddimvslaaaegidwieykrqlkkaeqwnvevy

SCOP Domain Coordinates for d1fnda2:

Click to download the PDB-style file with coordinates for d1fnda2.
(The format of our PDB-style files is described here.)

Timeline for d1fnda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fnda1