SCOP 1.71: Domain d1fnd_2: 1fnd 155-314

Lineage for d1fnd_2 (1fnd 155-314)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families)
   binds NADP differently than classical Rossmann-fold
   N-terminal FAD-linked domain contains (6,10) barrel

5. Family c.25.1.1: Reductases [52344] (4 proteins)

6. Protein Ferredoxin reductase (flavodoxin reductase) [52345] (8 species)

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [52346] (7 PDB entries)

8. Domain d1fnd_2: 1fnd 155-314 [31516]
   Other proteins in same PDB: d1fnd_1
   complexed with a2p, fad, so4

Details for d1fnd_2

PDB Entry: 1fnd, 1.7 Å

PDB Description: refined crystal structure of spinach ferredoxin reductase at 1.7 angstroms resolution: oxidized, reduced, and 2'-phospho-5'-amp bound states

SCOP Domain Sequences for d1fnd_2:

Sequence; same for both SEQRES and ATOM records:

>d1fnd_2 c.25.1.1 (155-314) Ferredoxin reductase (flavodoxin reductase) {Spinach (Spinacia oleracea)}
mlmpkdpnatiimlgtgtgiapfrsflwkmffekhddykfnglawlflgvptsssllyke
efekmkekapdnfrldfavsreqtnekgekmyiqtrmaqyavelwemlkkdntyvymcgl
kgmekgiddimvslaaaegidwieykrqlkkaeqwnvevy

Timeline for d1fnd_2:

• d1fnd_2 first appeared (with stable ids) in SCOP 1.55
  
• d1fnd_2 appears in SCOP 1.69
  
• d1fnd_2 is called d1fnda2 in SCOP 1.73
  
• d1fnd_2 appears in the current release, SCOPe 2.08, called d1fnda2