Lineage for d5hsfa_ (5hsf A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2748634Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)
  7. 2748637Species Human (Homo sapiens) [TaxId:9606] [88590] (69 PDB entries)
    Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region
  8. 2748642Domain d5hsfa_: 5hsf A: [315159]
    automated match to d1pfca_
    complexed with pge

Details for d5hsfa_

PDB Entry: 5hsf (more details), 1.52 Å

PDB Description: 1.52 angstrom crystal structure of fc fragment of human igg1.
PDB Compounds: (A:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d5hsfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hsfa_ b.1.1.2 (A:) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]}
gqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvlds
dgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslsp

SCOPe Domain Coordinates for d5hsfa_:

Click to download the PDB-style file with coordinates for d5hsfa_.
(The format of our PDB-style files is described here.)

Timeline for d5hsfa_: