Lineage for d5hj1a_ (5hj1 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2056344Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2056345Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2056880Family b.36.1.0: automated matches [191362] (1 protein)
    not a true family
  6. 2056881Protein automated matches [190436] (8 species)
    not a true protein
  7. 2057057Species Klebsiella pneumoniae [TaxId:484021] [315150] (1 PDB entry)
  8. 2057058Domain d5hj1a_: 5hj1 A: [315151]
    automated match to d2i6va1
    complexed with vca

Details for d5hj1a_

PDB Entry: 5hj1 (more details), 1.5 Å

PDB Description: crystal structure of pdz domain of pullulanase c protein of type ii secretion system from klebsiella pneumoniae in complex with fatty acid
PDB Compounds: (A:) Pullulanase C protein

SCOPe Domain Sequences for d5hj1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hj1a_ b.36.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 484021]}
plvkrlreqpqniltylsispvlsgdkllgyrlnpgkdaslfrqsglqandlaialngid
lrdqeqaqqalqnladmteitltveregqrhdiafal

SCOPe Domain Coordinates for d5hj1a_:

Click to download the PDB-style file with coordinates for d5hj1a_.
(The format of our PDB-style files is described here.)

Timeline for d5hj1a_: