Class b: All beta proteins [48724] (177 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) peptide-binding domain |
Family b.36.1.0: automated matches [191362] (1 protein) not a true family |
Protein automated matches [190436] (8 species) not a true protein |
Species Klebsiella pneumoniae [TaxId:484021] [315150] (1 PDB entry) |
Domain d5hj1a_: 5hj1 A: [315151] automated match to d2i6va1 complexed with vca |
PDB Entry: 5hj1 (more details), 1.5 Å
SCOPe Domain Sequences for d5hj1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hj1a_ b.36.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 484021]} plvkrlreqpqniltylsispvlsgdkllgyrlnpgkdaslfrqsglqandlaialngid lrdqeqaqqalqnladmteitltveregqrhdiafal
Timeline for d5hj1a_: